CacheBy
Atlas Antibodies Anti-FFAR4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FFAR4 Antibody

상품 한눈에 보기

인간 FFAR4 단백질을 인식하는 폴리클로날 항체로, free fatty acid receptor 4 연구에 적합합니다. 토끼 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증되었으며, IHC 등 다양한 응용에 사용 가능합니다.

카탈로그번호
HPA042563-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042563-100 Anti-FFAR4 Antibody, free fatty acid receptor 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042563-25 Anti-FFAR4 Antibody, free fatty acid receptor 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FFAR4 Antibody

Anti-FFAR4 Antibody

Target Information

  • Target Protein: Free fatty acid receptor 4
  • Target Gene: FFAR4
  • Alternative Gene Names: GPR120, GPR129, O3FAR1, PGR4

Product Description

Polyclonal antibody against human FFAR4. Suitable for research applications involving free fatty acid receptor 4.

  • Immunohistochemistry (IHC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: FRVVPQRLPGADQEISICTLIWPTIPGEISWDV

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000021763 82%
Mouse ENSMUSG00000054200 82%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

Component Description
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.
  • Open Datasheet (PDF)

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.