AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FFAR4 Antibody
상품 한눈에 보기
인간 FFAR4 단백질을 인식하는 폴리클로날 항체로, free fatty acid receptor 4 연구에 적합합니다. 토끼 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증되었으며, IHC 등 다양한 응용에 사용 가능합니다.
- 카탈로그번호
- HPA042563-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042563-100 Anti-FFAR4 Antibody, free fatty acid receptor 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042563-25 Anti-FFAR4 Antibody, free fatty acid receptor 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FFAR4 Antibody
Anti-FFAR4 Antibody
Target Information
- Target Protein: Free fatty acid receptor 4
- Target Gene: FFAR4
- Alternative Gene Names: GPR120, GPR129, O3FAR1, PGR4
Product Description
Polyclonal antibody against human FFAR4. Suitable for research applications involving free fatty acid receptor 4.
Recommended Applications
- Immunohistochemistry (IHC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence: FRVVPQRLPGADQEISICTLIWPTIPGEISWDV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000021763 | 82% |
| Mouse | ENSMUSG00000054200 | 82% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| Component | Description |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
- Open Datasheet (PDF)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.