CacheBy
Atlas Antibodies Anti-FEM1C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FEM1C Antibody

상품 한눈에 보기

Human FEM1C 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. FEM1C 단백질 연구 및 발현 분석에 활용 가능하며, 높은 종간 보존성을 가집니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059919-100 Anti-FEM1C Antibody, fem-1 homolog c (C. elegans) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059919-25 Anti-FEM1C Antibody, fem-1 homolog c (C. elegans) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FEM1C Antibody

Anti-FEM1C Antibody

Target Information

  • Target Protein: fem-1 homolog c (C. elegans)
  • Target Gene: FEM1C
  • Alternative Gene Names: EUROIMAGE686608, EUROIMAGE783647, FEM1A, KIAA1785
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human FEM1C.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    NLLIKSGAHFDATNLHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGHI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000003578 (98%)
  • Mouse: ENSMUSG00000033319 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Safety Information

Material Safety Data Sheet

Additional Resources

Open Datasheet (PDF)

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.