Atlas Antibodies Anti-FCER1G Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA026872-100 | - | Atlas Antibodies HPA026872-100 Anti-FCER1G Antibody, Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA026872-25 | - | Atlas Antibodies HPA026872-25 Anti-FCER1G Antibody, Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-FCER1G Antibody
Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
Recommended Applications
Product Description
Polyclonal Antibody against Human FCER1G
Target Protein
Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
Target Gene
FCER1G
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000024159 (88%)
Mouse ENSMUSG00000058715 (85%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|