CacheBy
Atlas Antibodies Anti-FBXW2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FBXW2 Antibody

상품 한눈에 보기

Human FBXW2 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. PBS와 글리세롤 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067878-100 Anti-FBXW2 Antibody, F-box and WD repeat domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067878-25 Anti-FBXW2 Antibody, F-box and WD repeat domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FBXW2 Antibody

Anti-FBXW2 Antibody

제품 개요

  • Target Protein: F-box and WD repeat domain containing 2 (FBXW2)
  • Antibody Type: Polyclonal antibody against human FBXW2
  • Recommended Applications: IHC, ICC

Alternative Gene Names

FBW2, Fwd2, Md6

Open Datasheet (PDF)


항원 정보

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    LYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000018687 100%
Mouse ENSMUSG00000035949 99%

항체 특성

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer 구성


사용 시 주의사항

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.