CacheBy
Atlas Antibodies Anti-FBXL6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FBXL6 Antibody

상품 한눈에 보기

인체 FBXL6 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC 실험에 적합합니다. 정제된 PrEST 항원 기반 친화 정제 방식으로 제조되었으며, 사람에 대한 반응성이 검증되었습니다. 토끼 유래 IgG 형식으로 안정적인 PBS/glycerol 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008867-100 Anti-FBXL6 Antibody, F-box and leucine-rich repeat protein 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008867-25 Anti-FBXL6 Antibody, F-box and leucine-rich repeat protein 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FBXL6 Antibody

Anti-FBXL6 Antibody

F-box and leucine-rich repeat protein 6


  • WB (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human FBXL6


Alternative Gene Names

  • FBL6

Open Datasheet


Target Information

항목 내용
Target Protein F-box and leucine-rich repeat protein 6
Target Gene FBXL6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence INRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVAPGPGFPSLEELCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGTSD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000022559 83%
Rat ENSRNOG00000025497 82%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Orthogonal Validation
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.