CacheBy
Atlas Antibodies Anti-FBXL14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FBXL14 Antibody

상품 한눈에 보기

Human FBXL14 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 실험에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 다양한 종 간 교차 반응성 정보 포함. 연구용으로 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053889-100 Anti-FBXL14 Antibody, F-box and leucine-rich repeat protein 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053889-25 Anti-FBXL14 Antibody, F-box and leucine-rich repeat protein 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FBXL14 Antibody

Anti-FBXL14 Antibody

F-box and leucine-rich repeat protein 14


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human FBXL14.


Alternative Gene Names

  • Fbl14
  • MGC40195

Open Datasheet


Target Information

항목 내용
Target Protein F-box and leucine-rich repeat protein 14
Target Gene FBXL14
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000030019 (78%), Rat ENSRNOG00000025497 (33%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.