
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FBLN5 Antibody
상품 한눈에 보기
Human FBLN5 단백질을 인식하는 토끼 폴리클로날 항체로, fibulin 5 단백질 검출에 적합합니다. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원을 이용해 친화 정제되었습니다. 사람에 특이적이며, 높은 종간 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA000848-100 Anti-FBLN5 Antibody, fibulin 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000848-25 Anti-FBLN5 Antibody, fibulin 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FBLN5 Antibody
Anti-FBLN5 Antibody
Target Information
- Target Protein: fibulin 5
- Target Gene: FBLN5
- Alternative Gene Names: ARMD3, DANCE, EVEC, UP50
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human FBLN5.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
TYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000050539 | 93% |
| Mouse | ENSMUSG00000021186 | 92% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



