
원본
Atlas Antibodies Anti-FAR2 Antibody
상품 한눈에 보기
인간 FAR2 단백질에 특이적인 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA015884-100 Anti-FAR2 Antibody, fatty acyl CoA reductase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015884-25 Anti-FAR2 Antibody, fatty acyl CoA reductase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FAR2 Antibody
Anti-FAR2 Antibody
Target Information
- Target Protein: Fatty acyl CoA reductase 2
- Target Gene: FAR2
- Alternative Gene Names: FLJ10462, MLSTD1, SDR10E2
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human FAR2.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
FLGKVLMEKLFRTSPDLKVIYILVRPKAGQTLQQRVFQILDSKLFEKVKEVCPNVHEKIRAIYADLNQNDFAISKEDMQELLSCTNIIFHCAATVRFDD
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000030303 | 91% |
| Rat | ENSRNOG00000001851 | 90% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



