CacheBy
Atlas Antibodies Anti-FARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FARS2 Antibody

상품 한눈에 보기

인간 FARS2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. 재조합 발현 단백질로 검증되었으며, 고순도의 친화정제 방식으로 제조되었습니다. 다양한 포유류 종과 높은 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028836-100 Anti-FARS2 Antibody, phenylalanyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028836-25 Anti-FARS2 Antibody, phenylalanyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FARS2 Antibody

Anti-FARS2 Antibody

Target: phenylalanyl-tRNA synthetase 2, mitochondrial

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant expression validation)
    • Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against Human FARS2.

Alternative Gene Names

dJ236A3.1, FARS1

Open Datasheet

Target Information

항목 내용
Target Protein phenylalanyl-tRNA synthetase 2, mitochondrial
Target Gene FARS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGES
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000016135 (94%), Mouse ENSMUSG00000021420 (92%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Tooltip Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.