Atlas Antibodies Anti-FANCA Antibody

상품 한눈에 보기

인간 FANCA 단백질을 인식하는 폴리클로날 항체로, 면역세포화학 등 다양한 연구 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화정제되었습니다. 인간에 대한 반응성이 검증되었으며, 안전한 보존용 버퍼가 포함되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA063236-100 Anti-FANCA Antibody, Fanconi anemia, complementation group A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA063236-25 Anti-FANCA Antibody, Fanconi anemia, complementation group A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human FANCA, produced in rabbit.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LQALTSGWSVAASLQRQRELLMYKRILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFF

Highest antigen sequence identity to the following orthologs:

면역세포화학(ICC) 등 다양한 연구 응용에 적합합니다.

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Verified Reactivity	Human
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.