CacheBy
Atlas Antibodies Anti-FAM26E Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FAM26E Antibody

상품 한눈에 보기

Human FAM26E 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Mouse, Rat과 79% 서열 유사성을 보임. PBS/glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034970-100 Anti-FAM26E Antibody, family with sequence similarity 26, member E 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034970-25 Anti-FAM26E Antibody, family with sequence similarity 26, member E 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FAM26E Antibody

Anti-FAM26E Antibody

Target: family with sequence similarity 26, member E (FAM26E)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human FAM26E.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

C6orf188, dJ493F7.3, MGC45451


Target Information

  • Target Protein: family with sequence similarity 26, member E
  • Target Gene: FAM26E
  • Antigen Sequence:
    Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    YECAMSGTRSSGLLELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000049872): 79%
  • Rat (ENSRNOG00000000825): 79%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Applications Recommended for IHC and related assays
Storage & Handling Gently mix before use. Optimize concentration per application.
Safety Material Safety Data Sheet

Additional Information

Open Datasheet (PDF)


제품 이미지

Recommended Applications: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.