Atlas Antibodies Anti-FAIM2 Antibody

상품 한눈에 보기

FAIM2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등에서 단백질 발현 검증에 적합. Human 시료에 반응하며 RNA-seq 데이터 기반 Orthogonal Validation 수행. PrEST 항원을 이용해 친화 정제된 고품질 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048800-100 Anti-FAIM2 Antibody, Fas apoptotic inhibitory molecule 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048800-25 Anti-FAIM2 Antibody, Fas apoptotic inhibitory molecule 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Fas apoptotic inhibitory molecule 2 (FAIM2)
Polyclonal Antibody against Human FAIM2

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGE
Interspecies Identity:
- Rat ENSRNOG00000053258 (93%)
- Mouse ENSMUSG00000023011 (91%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Storage & Handling	Gently mix before use. Optimal concentrations and conditions should be determined by the user.