Atlas Antibodies Anti-FABP2 Antibody

상품 한눈에 보기

Human FABP2 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증 완료. Recombinant PrEST 항원을 이용해 정제되었으며, 사람에 대한 반응성이 확인됨. Rabbit 유래 IgG 항체로 다양한 생물학 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA034607-100 Anti-FABP2 Antibody, fatty acid binding protein 2, intestinal 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA034607-25 Anti-FABP2 Antibody, fatty acid binding protein 2, intestinal 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

fatty acid binding protein 2, intestinal

Orthogonal validation (IHC): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Recombinant expression validation (WB): Recombinant expression validation in WB using target protein overexpression.

Polyclonal Antibody against Human FABP2

항목	내용
Target Protein	fatty acid binding protein 2, intestinal
Target Gene	FABP2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEA
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000023057 (72%), Rat ENSRNOG00000024947 (66%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand