CacheBy
Atlas Antibodies Anti-FA2H Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FA2H Antibody

상품 한눈에 보기

FA2H 단백질을 인식하는 사람 유래 폴리클로날 항체로, 지방산 2-하이드록실화 효소 연구용에 적합합니다. 토끼에서 생산된 IgG 항체이며, Human 반응성 검증 완료. IHC 등 다양한 응용 가능하며, 친화 정제 방식으로 높은 특이성 확보.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056614-100 Anti-FA2H Antibody, fatty acid 2-hydroxylase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056614-25 Anti-FA2H Antibody, fatty acid 2-hydroxylase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FA2H Antibody

Anti-FA2H Antibody

Target: Fatty acid 2-hydroxylase (FA2H)
Supplier: Atlas Antibodies

면역조직화학 (IHC) 등 다양한 연구 응용에 적합

Product Description

Polyclonal Antibody against Human FA2H

Alternative Gene Names

FAAH, FAXDC1, FLJ25287, SPG35

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Fatty acid 2-hydroxylase
Target Gene FA2H
Verified Species Reactivity Human
Interspecies Identity Rat (95%), Mouse (92%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.