CacheBy
Atlas Antibodies Anti-EYA3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EYA3 Antibody

상품 한눈에 보기

Human EYA3 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원을 이용해 친화 정제되었습니다. 다양한 종 간 높은 서열 유사성을 보이며, 40% glycerol buffer로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062889-100 Anti-EYA3 Antibody, EYA transcriptional coactivator and phosphatase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062889-25 Anti-EYA3 Antibody, EYA transcriptional coactivator and phosphatase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EYA3 Antibody

Anti-EYA3 Antibody

EYA transcriptional coactivator and phosphatase 3


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human EYA3.


Alternative Gene Names

  • DKFZp686C132

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein EYA transcriptional coactivator and phosphatase 3
Target Gene EYA3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000010396 (98%)
  • Mouse: ENSMUSG00000028886 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.