CacheBy
Atlas Antibodies Anti-EZH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EZH1 Antibody

상품 한눈에 보기

인간 EZH1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증되었고, 보존용으로 sodium azide가 포함된 PBS 버퍼를 사용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077684-100 Anti-EZH1 Antibody, enhancer of zeste 1 polycomb repressive complex 2 subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077684-25 Anti-EZH1 Antibody, enhancer of zeste 1 polycomb repressive complex 2 subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EZH1 Antibody

Anti-EZH1 Antibody

Target: enhancer of zeste 1 polycomb repressive complex 2 subunit
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Product Description

Polyclonal antibody against Human EZH1.

Alternative Gene Names

KIAA0388, KMT6B

Open Datasheet

Target Information

항목 내용
Target Protein enhancer of zeste 1 polycomb repressive complex 2 subunit
Target Gene EZH1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Antigen Sequence:
YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000006920 (96%)
  • Rat ENSRNOG00000020336 (92%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.