CacheBy
Atlas Antibodies Anti-EYA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EYA2 Antibody

상품 한눈에 보기

Human EYA2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 대한 검증 완료, Rat 및 Mouse와 높은 서열 유사성 보유. 안정한 PBS/glycerol buffer에 보존.

카탈로그번호
HPA059291-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059291-100 Anti-EYA2 Antibody, EYA transcriptional coactivator and phosphatase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059291-25 Anti-EYA2 Antibody, EYA transcriptional coactivator and phosphatase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EYA2 Antibody

Anti-EYA2 Antibody

Target Information

  • Target Protein: EYA transcriptional coactivator and phosphatase 2
  • Target Gene: EYA2
  • Alternative Gene Names: EAB1

Product Description

Polyclonal antibody against Human EYA2.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    GTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000019203 88%
Mouse ENSMUSG00000017897 86%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Component Description
Base Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
Safety Info Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.