CacheBy
Atlas Antibodies Anti-EXOC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EXOC3 Antibody

상품 한눈에 보기

Human EXOC3 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합. SEC6L1/Sec6p 대체 명칭을 가짐. 고순도 Affinity 정제 방식으로 제조되며, 인간, 쥐, 생쥐에서 높은 반응성을 보임. 40% 글리세롤 기반 버퍼로 안정화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037880-100 Anti-EXOC3 Antibody, exocyst complex component 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037880-25 Anti-EXOC3 Antibody, exocyst complex component 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EXOC3 Antibody

Anti-EXOC3 Antibody

Target: exocyst complex component 3 (EXOC3)
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human EXOC3.


Alternative Gene Names

  • SEC6L1
  • Sec6p

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein exocyst complex component 3
Target Gene EXOC3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMV

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000039776 98%
Mouse ENSMUSG00000034152 98%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.