CacheBy
Atlas Antibodies Anti-EXOC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EXOC1 Antibody

상품 한눈에 보기

Human EXOC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western Blot에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 가짐. 40% 글리세롤과 PBS 완충액에 저장됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044873-100 Anti-EXOC1 Antibody, exocyst complex component 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044873-25 Anti-EXOC1 Antibody, exocyst complex component 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EXOC1 Antibody

Anti-EXOC1 Antibody

Target: exocyst complex component 1 (EXOC1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human EXOC1.


Alternative Gene Names

BM-102, FLJ10893, SEC3, SEC3L1, Sec3p

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein exocyst complex component 1
Target Gene EXOC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FKLQQHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTA
Verified Species Reactivity Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000036435 87%
Rat ENSRNOG00000002144 85%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.