Atlas Antibodies Anti-EVPL Antibody

상품 한눈에 보기

인간 EVPL 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반 직교 검증 완료. 토끼 유래 IgG로 PrEST 항원 친화 정제. 글리세롤/PBS 완충액에 보존제 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA053969-100 Anti-EVPL Antibody, envoplakin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA053969-25 Anti-EVPL Antibody, envoplakin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-EVPL Antibody

Anti-EVPL Antibody

Target Information

Target Protein: envoplakin
Target Gene: EVPL
Alternative Gene Names: EVPK

Product Description

Polyclonal antibody against human EVPL.

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Orthogonal validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

DVGPRVDWARVLEQKQKQVCAGQYGPGMAELEQQIAEHNILQKEIDAYGQQLRSLVGPDAATIRSQYRDLLKAASWRGQSLGSLYTHLQ

Species Reactivity

Verified Species: Human
Interspecies Information:
- Mouse ENSMUSG00000034282 (85%)
- Rat ENSRNOG00000009343 (85%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet