Atlas Antibodies Anti-EVI5L Antibody

상품 한눈에 보기

Human EVI5L 단백질을 인식하는 폴리클로날 항체로, WB 및 IHC 실험에 적합. Recombinant expression 검증 완료. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. Human 종에 반응성이 검증된 고품질 연구용 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043563-100 Anti-EVI5L Antibody, ecotropic viral integration site 5-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043563-25 Anti-EVI5L Antibody, ecotropic viral integration site 5-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Ecotropic viral integration site 5-like (EVI5L)
Supplier: Atlas Antibodies

Immunohistochemistry (IHC)
Western Blot (WB) – Recombinant expression validation using target protein overexpression

Polyclonal Antibody against Human EVI5L
Open Datasheet (PDF)

항목	내용
Target Protein	Ecotropic viral integration site 5-like
Target Gene	EVI5L
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (96%), Rat (51%)

Antigen Sequence:

VVRQQCSSAAEDLQKAQSTIRQLQEQQENPRLTEDFVSHLETELEQSRLRETETL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand