CacheBy
Atlas Antibodies Anti-EVI2A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EVI2A Antibody

상품 한눈에 보기

Human EVI2A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인체 반응성이 검증되어 연구용으로 신뢰성 높음.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045033-100 Anti-EVI2A Antibody, ecotropic viral integration site 2A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045033-25 Anti-EVI2A Antibody, ecotropic viral integration site 2A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EVI2A Antibody

Anti-EVI2A Antibody

Target: ecotropic viral integration site 2A (EVI2A)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human EVI2A protein.

Alternative Gene Names

  • EVDA
  • EVI2

Open Datasheet

Target Information

항목 내용
Target Protein ecotropic viral integration site 2A
Target Gene EVI2A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTE

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Rat ENSRNOG00000022764 87%
Mouse ENSMUSG00000078771 84%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.