CacheBy
Atlas Antibodies Anti-ETV1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ETV1 Antibody

상품 한눈에 보기

Human ETV1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태입니다. WB 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 특이적으로 반응하며 Rat, Mouse와 94% 서열 동일성을 가집니다.

카탈로그번호
HPA068389-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068389-100 Anti-ETV1 Antibody, ETS variant 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068389-25 Anti-ETV1 Antibody, ETS variant 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ETV1 Antibody

Anti-ETV1 Antibody

Target Information

  • Target Protein: ETS variant 1
  • Target Gene: ETV1
  • Alternative Gene Names: ER81

Product Description

Polyclonal antibody against Human ETV1.

Western Blot (WB)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000006867): 94%
  • Mouse (ENSMUSG00000004151): 94%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

제품 이미지

Recommended Application: WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.