CacheBy
Atlas Antibodies Anti-ETS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ETS1 Antibody

상품 한눈에 보기

인간 ETS1 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. WB 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종간 반응성(인간, Rat 96%, Mouse 92%)을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063230-100 Anti-ETS1 Antibody, v-ets avian erythroblastosis virus E26 oncogene homolog 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063230-25 Anti-ETS1 Antibody, v-ets avian erythroblastosis virus E26 oncogene homolog 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ETS1 Antibody

Anti-ETS1 Antibody

Target: v-ets avian erythroblastosis virus E26 oncogene homolog 1 (ETS1)
Supplier: Atlas Antibodies

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ETS1.

Alternative Gene Names

ETS-1, EWSR2, FLJ10768

Open Datasheet

Target Information

  • Target Protein: v-ets avian erythroblastosis virus E26 oncogene homolog 1
  • Target Gene: ETS1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000008941 (96%)
  • Mouse ENSMUSG00000032035 (92%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.