CacheBy
Atlas Antibodies Anti-ETAA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ETAA1 Antibody

상품 한눈에 보기

사람 ETAA1 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. 토끼에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증되었으며, 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035048-100 Anti-ETAA1 Antibody, Ewing tumor-associated antigen 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035048-25 Anti-ETAA1 Antibody, Ewing tumor-associated antigen 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ETAA1 Antibody

Anti-ETAA1 Antibody

Target: Ewing tumor-associated antigen 1 (ETAA1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ETAA1 protein.


Alternative Gene Names

  • ETAA16

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Ewing tumor-associated antigen 1
Target Gene ETAA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence DMPELFPSKTAHVTDQKEICTFNSKTVKNTSRANTSPDARLGDSKVLQDLSSKTYDRELIDAEYRFSPNSNKSNK

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000006185 50%
Mouse ENSMUSG00000016984 45%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.