CacheBy
Atlas Antibodies Anti-ERICH4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ERICH4 Antibody

상품 한눈에 보기

Human ERICH4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 고순도, 높은 특이성, 인체 유래 단백질 검출에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042632-100 Anti-ERICH4 Antibody, glutamate-rich 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042632-25 Anti-ERICH4 Antibody, glutamate-rich 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ERICH4 Antibody

Anti-ERICH4 Antibody

Target Information

  • Target Protein: Glutamate-rich 4
  • Target Gene: ERICH4
  • Alternative Gene Names: C19orf69, LOC100170765

면역조직화학 (IHC)

Product Description

Polyclonal antibody against Human ERICH4.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SLLWIREELGNLRRVDVQLLGQLCSLGLEMGALREELVTILEEEEESSKEE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000037798 (86%)
  • Mouse ENSMUSG00000074261 (80%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 따라 결정해야 합니다.

Reference

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.