CacheBy
Atlas Antibodies Anti-ERBB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ERBB2 Antibody

상품 한눈에 보기

Human ERBB2(HER2/NEU) 단백질을 인식하는 rabbit polyclonal antibody로, 다양한 연구용 응용에 적합합니다. Recombinant PrEST 항원을 이용해 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대한 검증된 반응성을 보유합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001338-100 Anti-ERBB2 Antibody, erb-b2 receptor tyrosine kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001338-25 Anti-ERBB2 Antibody, erb-b2 receptor tyrosine kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ERBB2 Antibody

Anti-ERBB2 Antibody

Target: erb-b2 receptor tyrosine kinase 2 (ERBB2)
Supplier: Atlas Antibodies


Immunocytochemistry (ICC)


Product Description

Polyclonal antibody against human ERBB2.


Alternative Gene Names

CD340, HER-2, HER2, NEU, NGL

Open Datasheet (PDF)


Target Information

  • Target Protein: erb-b2 receptor tyrosine kinase 2
  • Target Gene: ERBB2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:

LVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDGAPHR

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000006450 86%
Mouse ENSMUSG00000062312 85%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.