CacheBy
Atlas Antibodies Anti-EPOR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EPOR Antibody

상품 한눈에 보기

인체 EPOR 단백질에 특이적인 폴리클로날 항체로, 적혈구 생성 관련 연구에 적합함. Rabbit 호스트에서 생산되었으며 IgG 아이소타입. Affinity purification으로 높은 특이성과 순도를 보장. Human 시료에 검증됨.

카탈로그번호
HPA077654-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077654-100 Anti-EPOR Antibody, erythropoietin receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077654-25 Anti-EPOR Antibody, erythropoietin receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EPOR Antibody

Anti-EPOR Antibody

Target Information

  • Target Protein: Erythropoietin receptor
  • Target Gene: EPOR
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000006235 (80%)
  • Rat ENSRNOG00000012619 (80%)

Product Description

Polyclonal Antibody against Human EPOR

Open Datasheet (PDF)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

ICC (Immunocytochemistry)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.