CacheBy
Atlas Antibodies Anti-EPN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EPN1 Antibody

상품 한눈에 보기

인간 EPN1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 연구 응용에 적합합니다. Human에 대해 검증된 반응성을 가지며, 안정적인 PBS/glycerol buffer에 보존됩니다.

카탈로그번호
HPA061136-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061136-100 Anti-EPN1 Antibody, epsin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061136-25 Anti-EPN1 Antibody, epsin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EPN1 Antibody

Anti-EPN1 Antibody

Target Protein: epsin 1
Supplier: Atlas Antibodies

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human EPN1.

Open Datasheet

Target Information

항목 내용
Target Protein epsin 1
Target Gene EPN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (81%), Rat (79%)

Antigen Sequence:
AIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPAPMAAAVPTAAPTSDPWGGPPVPPAADPW

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.