AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EPHX1 Antibody
상품 한눈에 보기
Human EPHX1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. PrEST 항원을 이용한 친화정제 제품. 인체 및 설치류 교차 반응성 확인. 단백질 발현 검증에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA020593-100 Anti-EPHX1 Antibody, epoxide hydrolase 1, microsomal (xenobiotic) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020593-25 Anti-EPHX1 Antibody, epoxide hydrolase 1, microsomal (xenobiotic) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EPHX1 Antibody
Anti-EPHX1 Antibody
epoxide hydrolase 1, microsomal (xenobiotic)
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human EPHX1.
Alternative Gene Names: EPHX
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | epoxide hydrolase 1, microsomal (xenobiotic) |
| Target Gene | EPHX1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRHPHFKTKIEGLDIHFI |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000038776 | 83% |
| Rat | ENSRNOG00000003515 | 83% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.