CacheBy
Atlas Antibodies Anti-EPC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EPC1 Antibody

상품 한눈에 보기

Human EPC1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification으로 높은 특이성과 순도 확보. ICC 등 다양한 응용에 적합. Human에 대해 검증된 반응성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028931-100 Anti-EPC1 Antibody, enhancer of polycomb homolog 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028931-25 Anti-EPC1 Antibody, enhancer of polycomb homolog 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EPC1 Antibody

Anti-EPC1 Antibody

Target: enhancer of polycomb homolog 1 (EPC1)
Supplier: Atlas Antibodies


이미지에 표시된 내용: ICC (Immunocytochemistry)


Product Description

Polyclonal antibody against Human EPC1.


Alternative Gene Names

  • Epl1

Open Datasheet


Target Information

  • Target Protein: enhancer of polycomb homolog 1
  • Target Gene: EPC1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DYDSVFHHLDLEMLSSPQHSPVNQFANTSETNTSDKSFSKDLSQILVNIKSCRWRHFRPRTPSLHDSDNDELSCRKLYRSINRTGTAQPGTQTCSTSTQSKSSSGSAHFAFTAEQYQQHQQQLALMQKQQLAQIQQQQA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000024240 83%
Rat ENSRNOG00000014834 83%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.