Atlas Antibodies Anti-EPAS1 Antibody

상품 한눈에 보기

인간 EPAS1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, 면역세포화학 등 다양한 연구용에 적합함. 고순도 친화 정제 방식으로 제조되었으며, 인간에 높은 반응성을 보임. 안정적인 PBS/glycerol 버퍼에 보존됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031200-100 Anti-EPAS1 Antibody, endothelial PAS domain protein 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031200-25 Anti-EPAS1 Antibody, endothelial PAS domain protein 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human EPAS1.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	ICC (Immunocytochemistry)
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.