CacheBy
Atlas Antibodies Anti-ENTPD3 Antibody
원본

Atlas Antibodies Anti-ENTPD3 Antibody

상품 한눈에 보기

인간 ENTPD3 단백질에 대한 폴리클로날 항체로, 면역세포 표면 효소 연구에 적합합니다. Rabbit에서 생산된 IgG 형식이며, 높은 특이성과 재현성을 제공합니다. 다양한 종 간 교차 반응성 정보 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071802-100 Anti-ENTPD3 Antibody, ectonucleoside triphosphate diphosphohydrolase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071802-25 Anti-ENTPD3 Antibody, ectonucleoside triphosphate diphosphohydrolase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ENTPD3 Antibody

Anti-ENTPD3 Antibody

Target Protein: ectonucleoside triphosphate diphosphohydrolase 3
Supplier: Atlas Antibodies


면역세포 표면 효소 ENTPD3 연구용 항체로 다양한 면역학적 분석에 사용 가능합니다.
(ICC 등 응용 가능)


Product Description

Polyclonal Antibody against Human ENTPD3


Alternative Gene Names

  • CD39L3
  • HB6
  • NTPDase-3

Open Datasheet


Target Information

항목 내용
Target Protein ectonucleoside triphosphate diphosphohydrolase 3
Target Gene ENTPD3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (81%), Rat (79%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

TGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGAT

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.