CacheBy
Atlas Antibodies Anti-ENGASE Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ENGASE Antibody

상품 한눈에 보기

Human ENGASE 단백질을 인식하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종간 서열 유사성을 보유하며, 안정적 PBS/glycerol 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021551-100 Anti-ENGASE Antibody, endo-beta-N-acetylglucosaminidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021551-25 Anti-ENGASE Antibody, endo-beta-N-acetylglucosaminidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ENGASE Antibody

Anti-ENGASE Antibody

Target Information

  • Target Protein: endo-beta-N-acetylglucosaminidase
  • Target Gene: ENGASE
  • Alternative Gene Names: FLJ21865
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ENGASE.

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    DKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000027498): 86%
  • Mouse (ENSMUSG00000033857): 85%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.