CacheBy
Atlas Antibodies Anti-EN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EN2 Antibody

상품 한눈에 보기

인간 EN2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 제작된 IgG 타입입니다. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 특이적 정제되었습니다. Human에 대해 검증되었으며, 40% glycerol과 PBS buffer로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069809-100 Anti-EN2 Antibody, engrailed homeobox 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069809-25 Anti-EN2 Antibody, engrailed homeobox 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EN2 Antibody

Anti-EN2 Antibody

Target: Engrailed homeobox 2 (EN2)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human EN2.

Open Datasheet

Target Information

항목 내용
Target Protein Engrailed homeobox 2
Target Gene EN2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (87%), Rat (87%)

Antigen Sequence:

SDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.