
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EMSY Antibody
상품 한눈에 보기
인간 EMSY 단백질을 인식하는 토끼 폴리클로날 항체로, BRCA2 결합 전사 억제인자 연구에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 면역세포화학 등 다양한 응용에 추천됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050777-100 Anti-EMSY Antibody, EMSY, BRCA2 interacting transcriptional repressor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050777-25 Anti-EMSY Antibody, EMSY, BRCA2 interacting transcriptional repressor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EMSY Antibody
Anti-EMSY Antibody
EMSY, BRCA2 interacting transcriptional repressor
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human EMSY.
Alternative Gene Names
- C11orf30
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | EMSY, BRCA2 interacting transcriptional repressor |
| Target Gene | EMSY |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000035401 (95%) Rat ENSRNOG00000015560 (95%) |
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
HTAFTKHSEELGTEEGEVEEMDTLDPQTGLFYRSALTQSQSAKQQKLSQPPLEQTQLQVKTLQCFQTKQKQTIHLQADQLQHKLPQMPQLSIRHQKLTPLQQEQAQPKPDVQHTQHPMVAKDRQLPTLMAQPPQTVVQVLAVKTTQQL
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



