CacheBy
Atlas Antibodies Anti-SLC6A9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC6A9 Antibody

상품 한눈에 보기

Human SLC6A9 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. GLYT1로도 알려진 SLC6A9 단백질 검출에 사용되며, 고순도 친화정제 방식으로 제조되었습니다. 인간에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA013977-100 Anti-SLC6A9 Antibody, solute carrier family 6 (neurotransmitter transporter, glycine), member 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013977-25 Anti-SLC6A9 Antibody, solute carrier family 6 (neurotransmitter transporter, glycine), member 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC6A9 Antibody

Anti-SLC6A9 Antibody

Target: solute carrier family 6 (neurotransmitter transporter, glycine), member 9
Alternative Gene Name: GLYT1

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SLC6A9.

Target Information

항목 내용
Target Protein solute carrier family 6 (neurotransmitter transporter, glycine), member 9
Target Gene SLC6A9
Alternative Name GLYT1
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000028542 (91%), Rat ENSRNOG00000019484 (88%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence YCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGE

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.