CacheBy
Atlas Antibodies Anti-SLC51A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC51A Antibody

상품 한눈에 보기

Human SLC51A 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC Orthogonal 검증 완료. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human 시료에 적합하며 Mouse, Rat에서도 높은 서열 유사성 보유.

카탈로그번호
HPA045488-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045488-100 Anti-SLC51A Antibody, solute carrier family 51 alpha subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045488-25 Anti-SLC51A Antibody, solute carrier family 51 alpha subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC51A Antibody

Anti-SLC51A Antibody

solute carrier family 51 alpha subunit


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SLC51A


Alternative Gene Names

  • OSTalpha

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 51 alpha subunit
Target Gene SLC51A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse (83%), Rat (81%)

Antigen Sequence:
MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGP


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.