Atlas Antibodies Anti-SLC4A4 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-SLC4A4 항체는 인간 SLC4A4 단백질을 타겟으로 하는 고품질 폴리클로날 항체입니다. IHC를 통한 Orthogonal Validation으로 검증되었으며, Rabbit 호스트에서 생산되고 IgG 아이소타입을 가집니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA035629-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035629-100 Anti-SLC4A4 Antibody, solute carrier family 4 (sodium bicarbonate cotransporter), member 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035629-25 Anti-SLC4A4 Antibody, solute carrier family 4 (sodium bicarbonate cotransporter), member 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC4A4 Antibody

Anti-SLC4A4 Antibody

Target: solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC4A4

Alternative Gene Names

hhNMC, HNBC1, NBC1, NBC2, pNBC, SLC4A5

Open Datasheet

Target Information

항목	내용
Target Protein	solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Target Gene	SLC4A4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS
Verified Species Reactivity	Human
Interspecies Identity	Mouse (95%), Rat (93%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand