
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC4A4 Antibody
상품 한눈에 보기
Atlas Antibodies의 Anti-SLC4A4 항체는 인간 SLC4A4 단백질을 타겟으로 하는 고품질 폴리클로날 항체입니다. IHC를 통한 Orthogonal Validation으로 검증되었으며, Rabbit 호스트에서 생산되고 IgG 아이소타입을 가집니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA035629-100 Anti-SLC4A4 Antibody, solute carrier family 4 (sodium bicarbonate cotransporter), member 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035629-25 Anti-SLC4A4 Antibody, solute carrier family 4 (sodium bicarbonate cotransporter), member 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC4A4 Antibody
Anti-SLC4A4 Antibody
Target: solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SLC4A4
Alternative Gene Names
hhNMC, HNBC1, NBC1, NBC2, pNBC, SLC4A5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 4 (sodium bicarbonate cotransporter), member 4 |
| Target Gene | SLC4A4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (95%), Rat (93%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



