CacheBy
Atlas Antibodies Anti-SLC4A10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC4A10 Antibody

상품 한눈에 보기

인간 SLC4A10 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 단백질 발현 분석에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인간에서 검증되었으며 설치류와 높은 상동성 보유.

카탈로그번호
HPA034755-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034755-100 Anti-SLC4A10 Antibody, solute carrier family 4, sodium bicarbonate transporter, member 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034755-25 Anti-SLC4A10 Antibody, solute carrier family 4, sodium bicarbonate transporter, member 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC4A10 Antibody

Anti-SLC4A10 Antibody

Target: solute carrier family 4, sodium bicarbonate transporter, member 10
Supplier: Atlas Antibodies


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human SLC4A10.


Alternative Gene Names

NBCn2, NCBE

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 4, sodium bicarbonate transporter, member 10
Target Gene SLC4A10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLT

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000005307 (91%)
  • Mouse ENSMUSG00000026904 (89%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.