
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC4A10 Antibody
상품 한눈에 보기
인간 SLC4A10 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 단백질 발현 분석에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인간에서 검증되었으며 설치류와 높은 상동성 보유.
- 카탈로그번호
- HPA034755-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034755-100 Anti-SLC4A10 Antibody, solute carrier family 4, sodium bicarbonate transporter, member 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034755-25 Anti-SLC4A10 Antibody, solute carrier family 4, sodium bicarbonate transporter, member 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC4A10 Antibody
Anti-SLC4A10 Antibody
Target: solute carrier family 4, sodium bicarbonate transporter, member 10
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human SLC4A10.
Alternative Gene Names
NBCn2, NCBE
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 4, sodium bicarbonate transporter, member 10 |
| Target Gene | SLC4A10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLT |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000005307 (91%)
- Mouse ENSMUSG00000026904 (89%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



