CacheBy
Atlas Antibodies Anti-SLC39A10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC39A10 Antibody

상품 한눈에 보기

Human SLC39A10 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 종간 보존성을 보입니다. 40% glycerol/PBS buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036512-100 Anti-SLC39A10 Antibody, solute carrier family 39 (zinc transporter), member 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036512-25 Anti-SLC39A10 Antibody, solute carrier family 39 (zinc transporter), member 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC39A10 Antibody

Anti-SLC39A10 Antibody

Target: solute carrier family 39 (zinc transporter), member 10
Type: Polyclonal Antibody against Human SLC39A10


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against the human SLC39A10 protein.


Alternative Gene Names

DKFZp564L2123, FLJ90515, KIAA1265

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 39 (zinc transporter), member 10
Target Gene SLC39A10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGL

Species Reactivity

항목 내용
Verified Reactivity Human
Ortholog Identity Rat ENSRNOG00000011677 (93%), Mouse ENSMUSG00000025986 (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.