CacheBy
Atlas Antibodies Anti-SLC38A10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC38A10 Antibody

상품 한눈에 보기

Human SLC38A10 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 실험에 적합하며 RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체로 다양한 조직 발현 연구에 활용 가능.

카탈로그번호
HPA024631-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024631-100 Anti-SLC38A10 Antibody, solute carrier family 38, member 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024631-25 Anti-SLC38A10 Antibody, solute carrier family 38, member 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC38A10 Antibody

Anti-SLC38A10 Antibody

Target: solute carrier family 38, member 10 (SLC38A10)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human SLC38A10.


Alternative Gene Names

MGC15523, PP1744


Target Information

항목 내용
Target Protein Solute carrier family 38, member 10
Target Gene SLC38A10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PVPHDKVVVDEGQDREVPEENKPPSRHAGGKAPGVQGQMAPPLPDSEREKQEPEQGEVGKRPGQAQALEEAGDLPEDPQKVPEADGQPA
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000061306 (64%), Rat ENSRNOG00000004604 (58%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.