
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC37A4 Antibody
상품 한눈에 보기
Human SLC37A4 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 기반 직교 검증 완료. 고순도 Affinity 정제 항체로 다양한 조직 발현 분석에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA038939-100 Anti-SLC37A4 Antibody, solute carrier family 37 (glucose-6-phosphate transporter), member 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038939-25 Anti-SLC37A4 Antibody, solute carrier family 37 (glucose-6-phosphate transporter), member 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC37A4 Antibody
Anti-SLC37A4 Antibody
Target: solute carrier family 37 (glucose-6-phosphate transporter), member 4
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
- ICC (Immunocytochemistry): Suitable for cellular localization studies.
Product Description
Polyclonal antibody against Human SLC37A4.
Alternative Gene Names
G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 37 (glucose-6-phosphate transporter), member 4 |
| Target Gene | SLC37A4 |
| Antigen Sequence | LDKDDLGFITSSQSAAYAISKFVSGVLSDQMS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000011361 (97%), Mouse ENSMUSG00000032114 (97%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



