CacheBy
Atlas Antibodies Anti-SLC36A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC36A2 Antibody

상품 한눈에 보기

인체 SLC36A2 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증 완료. Rabbit에서 생산된 IgG 항체로 높은 특이성과 재현성 제공. Affinity purification으로 정제된 연구용 시약.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA044002-100 Anti-SLC36A2 Antibody, solute carrier family 36 (proton/amino acid symporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044002-25 Anti-SLC36A2 Antibody, solute carrier family 36 (proton/amino acid symporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC36A2 Antibody

Anti-SLC36A2 Antibody

solute carrier family 36 (proton/amino acid symporter), member 2


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SLC36A2


Alternative Gene Names

PAT2, TRAMD1, tramdorin

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 36 (proton/amino acid symporter), member 2
Target Gene SLC36A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020264 (53%), Rat ENSRNOG00000011892 (53%)

Antigen Sequence:
QGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVF


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.