CacheBy
Atlas Antibodies Anti-SLC35E2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC35E2 Antibody

상품 한눈에 보기

인간 SLC35E2 단백질을 인식하는 폴리클로날 항체입니다. Rabbit 유래 IgG로, PrEST 항원 친화 정제 방식으로 제조되었습니다. 인체 반응성이 검증되었으며, IHC 등 다양한 응용에 적합합니다. PBS와 글리세롤 버퍼에 보존되어 안정적입니다.

카탈로그번호
HPA062711-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062711-100 Anti-SLC35E2 Antibody, solute carrier family 35, member E2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062711-25 Anti-SLC35E2 Antibody, solute carrier family 35, member E2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC35E2 Antibody

Anti-SLC35E2 Antibody

Target: solute carrier family 35, member E2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human SLC35E2.


Alternative Gene Names

  • KIAA0447

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 35, member E2
Target Gene SLC35E2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LGEYTGRPSDREEWEELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLP
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000010457 (34%), Mouse ENSMUSG00000070319 (34%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.