CacheBy
Atlas Antibodies Anti-SLC35B1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC35B1 Antibody

상품 한눈에 보기

인간 SLC35B1 단백질을 인식하는 토끼 폴리클로날 항체로, Affinity 정제된 고품질 제품입니다. ICC 등 다양한 응용에 적합하며, 40% 글리세롤 PBS 완충용액에 보존되어 있습니다. Rat 및 Mouse에서도 100% 서열 동일성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA057418-100 Anti-SLC35B1 Antibody, solute carrier family 35, member B1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057418-25 Anti-SLC35B1 Antibody, solute carrier family 35, member B1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC35B1 Antibody

Anti-SLC35B1 Antibody

Target: solute carrier family 35, member B1 (SLC35B1)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SLC35B1.


Alternative Gene Names

  • UGTREL1

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 35, member B1
Target Gene SLC35B1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP
Verified Species Reactivity Human
Ortholog Identity Rat ENSRNOG00000004510 (100%), Mouse ENSMUSG00000020873 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.