Atlas Antibodies Anti-SLC34A2 Antibody

상품 한눈에 보기

Human SLC34A2 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. Recombinant PrEST 항원으로 제작되었으며, 높은 특이성과 재현성을 제공. 인체 반응성 확인 및 RNA-seq 데이터 기반 검증 적용.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기

Atlas Antibodies HPA037989-100 Anti-SLC34A2 Antibody, solute carrier family 34 (type II sodium/phosphate contransporter), member 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037989-25 Anti-SLC34A2 Antibody, solute carrier family 34 (type II sodium/phosphate contransporter), member 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC34A2 Antibody

Anti-SLC34A2 Antibody

solute carrier family 34 (type II sodium/phosphate contransporter), member 2

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC34A2

Alternative Gene Names

NAPI-3B

Open Datasheet

Target Information

항목	내용
Target Protein	solute carrier family 34 (type II sodium/phosphate contransporter), member 2
Target Gene	SLC34A2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCGCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECT
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000004626 (59%), Mouse ENSMUSG00000029188 (57%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. [Material Safety Data Sheet]
Purification Method	Affinity purified using the PrEST antigen as affinity ligand