CacheBy
Atlas Antibodies Anti-SLC34A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC34A2 Antibody

상품 한눈에 보기

Human SLC34A2 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. Recombinant PrEST 항원으로 제작되었으며, 높은 특이성과 재현성을 제공. 인체 반응성 확인 및 RNA-seq 데이터 기반 검증 적용.

카탈로그번호
HPA037989-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037989-100 Anti-SLC34A2 Antibody, solute carrier family 34 (type II sodium/phosphate contransporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037989-25 Anti-SLC34A2 Antibody, solute carrier family 34 (type II sodium/phosphate contransporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC34A2 Antibody

Anti-SLC34A2 Antibody

solute carrier family 34 (type II sodium/phosphate contransporter), member 2


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SLC34A2


Alternative Gene Names

  • NAPI-3B

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 34 (type II sodium/phosphate contransporter), member 2
Target Gene SLC34A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCGCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECT
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000004626 (59%), Mouse ENSMUSG00000029188 (57%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. [Material Safety Data Sheet]
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.