CacheBy
Atlas Antibodies Anti-SLC27A6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC27A6 Antibody

상품 한눈에 보기

Human SLC27A6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 특이 정제되었으며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보존되어 안정성이 우수합니다.

카탈로그번호
HPA008987-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008987-100 Anti-SLC27A6 Antibody, solute carrier family 27 (fatty acid transporter), member 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008987-25 Anti-SLC27A6 Antibody, solute carrier family 27 (fatty acid transporter), member 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC27A6 Antibody

Anti-SLC27A6 Antibody

Target: solute carrier family 27 (fatty acid transporter), member 6
Type: Polyclonal Antibody against Human SLC27A6


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human SLC27A6.
Alternative Gene Names: ACSVL2, FACVL2, FATP6, VLCS-H1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 27 (fatty acid transporter), member 6
Target Gene SLC27A6
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000058193 (82%), Mouse ENSMUSG00000024600 (80%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LGTVEEILPSLSENISVWGMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWS

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.