Atlas Antibodies Anti-SLC25A31 Antibody

상품 한눈에 보기

Human SLC25A31 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. ANT4로도 알려진 SLC25A31을 특이적으로 검출하며, PrEST 항원으로 정제되었습니다. Human에 반응성이 검증되었습니다.

카탈로그번호: HPA016841-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA016841-100 Anti-SLC25A31 Antibody, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA016841-25 Anti-SLC25A31 Antibody, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC25A31 Antibody

Anti-SLC25A31 Antibody

Target: solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31
Type: Polyclonal Antibody against Human SLC25A31

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against Human SLC25A31 (solute carrier family 25 member 31).

Alternative Gene Names

ANT4
DKFZP434N1235

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31
Target Gene	SLC25A31
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	FARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRA
Verified Species Reactivity	Human
Ortholog Identity	Mouse ENSMUSG00000069041 (93%), Rat ENSRNOG00000038398 (93%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet