Atlas Antibodies Anti-SLC22A8 Antibody

상품 한눈에 보기

Human SLC22A8 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교된 신뢰성 높은 단백질 발현 분석에 적합합니다. Rabbit IgG 기반으로 제작되었으며, PrEST 항원으로 친화 정제되었습니다. Human에 반응성이 검증되었습니다.

카탈로그번호: HPA044174-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044174-100 Anti-SLC22A8 Antibody, solute carrier family 22 (organic anion transporter), member 8 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044174-25 Anti-SLC22A8 Antibody, solute carrier family 22 (organic anion transporter), member 8 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC22A8 Antibody

Anti-SLC22A8 Antibody

Target: solute carrier family 22 (organic anion transporter), member 8
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC22A8

Alternative Gene Names

OAT3

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	solute carrier family 22 (organic anion transporter), member 8
Target Gene	SLC22A8
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000063796 (68%), Rat ENSRNOG00000018086 (65%)

Antigen Sequence:
KKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLR

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand