CacheBy
Atlas Antibodies Anti-SLC22A8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC22A8 Antibody

상품 한눈에 보기

Human SLC22A8 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교된 신뢰성 높은 단백질 발현 분석에 적합합니다. Rabbit IgG 기반으로 제작되었으며, PrEST 항원으로 친화 정제되었습니다. Human에 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA044174-100 Anti-SLC22A8 Antibody, solute carrier family 22 (organic anion transporter), member 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044174-25 Anti-SLC22A8 Antibody, solute carrier family 22 (organic anion transporter), member 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC22A8 Antibody

Anti-SLC22A8 Antibody

Target: solute carrier family 22 (organic anion transporter), member 8
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC22A8

Alternative Gene Names

OAT3

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein solute carrier family 22 (organic anion transporter), member 8
Target Gene SLC22A8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000063796 (68%), Rat ENSRNOG00000018086 (65%)

Antigen Sequence:
KKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.